Recombinant Human CTHRC1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens collagen triple helix repeat containing 1 (CTHRC1), transcript variant 1 (NM_138455).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96CG8
Entry Name CTHR1_HUMAN
Gene Names CTHRC1 UNQ762/PRO1550
Alternative Gene Names
Alternative Protein Names Collagen triple helix repeat-containing protein 1
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 243
Molecular Weight(Da) 26224
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Background
Function FUNCTION: May act as a negative regulator of collagen matrix deposition. {ECO:0000250}.
Pathway
Protein Families
Tissue Specificity Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells. {ECO:0000269|PubMed:15618538}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8914535

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CTHRC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.